KCNH6 anticorps

N° du produit ABIN630086

Détail du produit anti-KCNH6 anticorps

Antigène: KCNH6 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 6 (KCNH6))

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNH6 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: KCNH6 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKYRTISQIPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEK

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNH6 Blocking Peptide, catalog no. 33R-3382, is also available for use as a blocking control in assays to test for specificity of this KCNH6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNH6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNH6

Antigène: KCNH6 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 6 (KCNH6))

Autre désignation: KCNH6 (KCNH6 Produits)

Synonymes: anticorps KCNH2, anticorps erg, anticorps ERG-2, anticorps ERG2, anticorps HERG2, anticorps Kv11.2, anticorps hERG-2, anticorps m-erg2, anticorps Erg2, anticorps potassium voltage-gated channel subfamily H member 6, anticorps potassium voltage-gated channel, subfamily H (eag-related), member 6, anticorps KCNH6, anticorps Kcnh6

Sujet: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNH6 encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit.

Poids moléculaire: 109 kDa (MW of target protein)