CHRNA5 anticorps (Middle Region)
-
- Antigène Voir toutes CHRNA5 Anticorps
- CHRNA5 (Cholinergic Receptor, Nicotinic, alpha 5 (Neuronal) (CHRNA5))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CHRNA5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CHRNA5 antibody was raised against the middle region of CHRNA5
- Purification
- Purified
- Immunogène
- CHRNA5 antibody was raised using the middle region of CHRNA5 corresponding to a region with amino acids DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYS
- Top Product
- Discover our top product CHRNA5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CHRNA5 Blocking Peptide, catalog no. 33R-1967, is also available for use as a blocking control in assays to test for specificity of this CHRNA5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CHRNA5 (Cholinergic Receptor, Nicotinic, alpha 5 (Neuronal) (CHRNA5))
- Autre désignation
- CHRNA5 (CHRNA5 Produits)
- Synonymes
- anticorps zgc:110642, anticorps LNCR2, anticorps Acra-5, anticorps Acra5, anticorps cholinergic receptor, nicotinic, alpha 5, anticorps cholinergic receptor nicotinic alpha 5 subunit, anticorps cholinergic receptor nicotinic alpha 5 subunit L homeolog, anticorps cholinergic receptor, nicotinic, alpha polypeptide 5, anticorps chrna5, anticorps CHRNA5, anticorps chrna5.L, anticorps Chrna5
- Sujet
- Nicotinic acetylcholine receptors (nAChRs), such as CHRNA5, are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be (hetero)pentamers composed of homologous subunits.
- Poids moléculaire
- 53 kDa (MW of target protein)
-