CHRNA5 anticorps (Middle Region)

N° du produit ABIN630102

Détail du produit anti-CHRNA5 anticorps

Antigène: CHRNA5 (Cholinergic Receptor, Nicotinic, alpha 5 (Neuronal) (CHRNA5))

Épitope: Middle Region

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHRNA5 est non-conjugé

Application: Western Blotting (WB)

Specificité: CHRNA5 antibody was raised against the middle region of CHRNA5

Purification: Purified

Immunogène: CHRNA5 antibody was raised using the middle region of CHRNA5 corresponding to a region with amino acids DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHRNA5 Blocking Peptide, catalog no. 33R-1967, is also available for use as a blocking control in assays to test for specificity of this CHRNA5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHRNA5

Antigène: CHRNA5 (Cholinergic Receptor, Nicotinic, alpha 5 (Neuronal) (CHRNA5))

Autre désignation: CHRNA5 (CHRNA5 Produits)

Synonymes: anticorps zgc:110642, anticorps LNCR2, anticorps Acra-5, anticorps Acra5, anticorps cholinergic receptor, nicotinic, alpha 5, anticorps cholinergic receptor nicotinic alpha 5 subunit, anticorps cholinergic receptor nicotinic alpha 5 subunit L homeolog, anticorps cholinergic receptor, nicotinic, alpha polypeptide 5, anticorps chrna5, anticorps CHRNA5, anticorps chrna5.L, anticorps Chrna5

Sujet: Nicotinic acetylcholine receptors (nAChRs), such as CHRNA5, are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be (hetero)pentamers composed of homologous subunits.

Poids moléculaire: 53 kDa (MW of target protein)