CHRNA7 anticorps (Middle Region)

N° du produit ABIN630113

Détail du produit anti-CHRNA7 anticorps

Antigène: CHRNA7 (Cholinergic Receptor, Nicotinic, alpha 7 (Neuronal) (CHRNA7))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHRNA7 est non-conjugé

Application: Western Blotting (WB)

Specificité: CHRNA7 antibody was raised against the middle region of CHRNA7

Purification: Purified

Immunogène: CHRNA7 antibody was raised using the middle region of CHRNA7 corresponding to a region with amino acids VPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRF

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHRNA7 Blocking Peptide, catalog no. 33R-9739, is also available for use as a blocking control in assays to test for specificity of this CHRNA7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHRNA7

Antigène: CHRNA7 (Cholinergic Receptor, Nicotinic, alpha 7 (Neuronal) (CHRNA7))

Autre désignation: CHRNA7 (CHRNA7 Produits)

Synonymes: anticorps CHRNA7-2, anticorps NACHRA7, anticorps dZ70B1.1, anticorps Acra7, anticorps alpha7, anticorps BTX, anticorps NARAD, anticorps nAChRa7, anticorps CHRNA7, anticorps cholinergic receptor nicotinic alpha 7 subunit, anticorps neuronal acetylcholine receptor subunit alpha-7, anticorps cholinergic receptor, nicotinic, alpha 7 (neuronal), anticorps cholinergic receptor, nicotinic, alpha polypeptide 7, anticorps cholinergic receptor, nicotinic, alpha 7, anticorps CHRNA7, anticorps LOC100374356, anticorps chrna7, anticorps Chrna7, anticorps LOC100060521

Sujet: The protein encoded by CHRNA7 displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene is located in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomal location involved in the genetic transmission of schizophrenia.

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: Synaptic Membrane