TRPM5 anticorps (N-Term)

N° du produit ABIN630115

Détail du produit anti-TRPM5 anticorps

Antigène: TRPM5 (Transient Receptor Potential Cation Channel, Subfamily M, Member 5 (TRPM5))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRPM5 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: TRPM5 antibody was raised against the N terminal of TRPM5

Purification: Purified

Immunogène: TRPM5 antibody was raised using the N terminal of TRPM5 corresponding to a region with amino acids AAPWLILVGSGGIADVLAALVNQPHLLVPKVAEKQFKEKFPSKHFSWEDI

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRPM5 Blocking Peptide, catalog no. 33R-1043, is also available for use as a blocking control in assays to test for specificity of this TRPM5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPM5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRPM5

Antigène: TRPM5 (Transient Receptor Potential Cation Channel, Subfamily M, Member 5 (TRPM5))

Autre désignation: TRPM5 (TRPM5 Produits)

Synonymes: anticorps LTRPC5, anticorps MTR1, anticorps 9430099A16Rik, anticorps LTrpC-5, anticorps Ltrpc5, anticorps Mtr1, anticorps transient receptor potential cation channel subfamily M member 5, anticorps transient receptor potential cation channel, subfamily M, member 5, anticorps TRPM5, anticorps Trpm5, anticorps trpm5

Sujet: TRPM5 is a voltage-modulated Ca(2+)-activated, monovalent cation channel (VCAM) that mediates a transient membrane depolarization and plays a central role in taste transduction. It is activated by arachidonic acid in vitro. It may be involved in perception of bitter, sweet and umami tastes. It may also be involved in sensing semiochemicals.

Poids moléculaire: 131 kDa (MW of target protein)