MMP7 anticorps

N° du produit ABIN630130

Détail du produit anti-MMP7 anticorps

Antigène: MMP7 (Matrix Metallopeptidase 7 (Matrilysin, Uterine) (MMP7))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MMP7 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: MMP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids AATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGK

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MMP7 Blocking Peptide, catalog no. 33R-1053, is also available for use as a blocking control in assays to test for specificity of this MMP7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MMP7

Antigène: MMP7 (Matrix Metallopeptidase 7 (Matrilysin, Uterine) (MMP7))

Autre désignation: MMP7 (MMP7 Produits)

Synonymes: anticorps MAT, anticorps MPMM, anticorps MMP-7, anticorps MPSL1, anticorps PUMP-1, anticorps matrilysin, anticorps LOC727698, anticorps MMP7, anticorps Matrilysin, anticorps matrix metallopeptidase 7, anticorps MMP7, anticorps Mmp7

Sujet: Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP7 degrades proteoglycans, fibronectin, elastin and casein and differs from most MMP family members in that it lacks a conserved C-terminal protein domain. The enzyme is involved in wound healing, and studies in mice suggest that it regulates the activity of defensins in intestinal mucosa.

Poids moléculaire: 19 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response