Chromogranin A anticorps

N° du produit ABIN630138

Détail du produit anti-Chromogranin A anticorps

Antigène: Chromogranin A (CHGA)

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Chromogranin A est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: Chromogranin A antibody was raised using a synthetic peptide corresponding to a region with amino acids PVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGF

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Chromogranin A Blocking Peptide, catalog no. 33R-7425, is also available for use as a blocking control in assays to test for specificity of this Chromogranin A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHGA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Chromogranin A

Antigène: Chromogranin A (CHGA)

Autre désignation: Chromogranin A (CHGA Produits)

Synonymes: anticorps CGA, anticorps CG-ALPHA, anticorps FSHA, anticorps GPHA1, anticorps GPHa, anticorps HCG, anticorps LHA, anticorps TSHA, anticorps ChrA, anticorps fj05f09, anticorps si:dkey-177p2.2, anticorps wu:fj05f09, anticorps zgc:101749, anticorps zgc:56075, anticorps CHGA, anticorps cgA, anticorps chga, anticorps chromogranin A, anticorps glycoprotein hormones, alpha polypeptide, anticorps uncharacterized CHGA, anticorps chromogranin A S homeolog, anticorps CHGA, anticorps CGA, anticorps Chga, anticorps chga, anticorps chga.S

Sujet: CHGA is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells. Its gene product is a precursor to three biologically active peptides, vasostatin, pancreastatin, and parastatin. These peptides act as autocrine or paracrine negative modulators of the neuroendocrine system. Other peptides, including chromostatin, beta-granin, WE-14 and GE-25, are also derived from the full-length protein. However, biological activities for these molecules have not been shown.

Poids moléculaire: 51 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion, cAMP Metabolic Process, Regulation of G-Protein Coupled Receptor Protein Signaling