TPTE anticorps (C-Term)
-
- Antigène Voir toutes TPTE Anticorps
- TPTE (Transmembrane Phosphatase with Tensin Homology (TPTE))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TPTE est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TPTE antibody was raised against the C terminal of TPTE
- Purification
- Purified
- Immunogène
- TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids MNESPDPTDLAGVIIELGPNDSPQTSEFKGATEEAPAKESVLARLSKFEV
- Top Product
- Discover our top product TPTE Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TPTE Blocking Peptide, catalog no. 33R-6243, is also available for use as a blocking control in assays to test for specificity of this TPTE antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPTE antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TPTE (Transmembrane Phosphatase with Tensin Homology (TPTE))
- Autre désignation
- TPTE (TPTE Produits)
- Synonymes
- anticorps CT44, anticorps PTEN2, anticorps Pten2, anticorps tpip, anticorps vsp, anticorps wu:fd20e11, anticorps wu:fi24b06, anticorps transmembrane phosphatase with tensin homology, anticorps TPTE, anticorps Tpte, anticorps tpte
- Sujet
- TPTE encodes a putative transmembrane tyrosine phosphatase that may be involved in signal transduction pathways of the endocrine or spermatogenetic function of the testis.
- Poids moléculaire
- 59 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-