Annexin V anticorps (N-Term)
-
- Antigène Voir toutes Annexin V (ANXA5) Anticorps
- Annexin V (ANXA5) (Annexin A5 (ANXA5))
-
Épitope
- N-Term
-
Reactivité
- Chemical
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Annexin V est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Annexin A5 antibody was raised against the N terminal of ANXA5
- Réactivité croisée
- Humain, Chien
- Purification
- Purified
- Immunogène
- Annexin A5 antibody was raised using the N terminal of ANXA5 corresponding to a region with amino acids AYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVV
- Top Product
- Discover our top product ANXA5 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.625 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Annexin A5 Blocking Peptide, catalog no. 33R-1626, is also available for use as a blocking control in assays to test for specificity of this Annexin A5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Annexin V (ANXA5) (Annexin A5 (ANXA5))
- Autre désignation
- Annexin A5 (ANXA5 Produits)
- Synonymes
- anticorps anx, anticorps anx5, anticorps ANX V, anticorps anxa5, anticorps cb989, anticorps wu:fa98f06, anticorps wu:fj10f10, anticorps MGC89158, anticorps ANX5, anticorps ENX2, anticorps PP4, anticorps RPRGL3, anticorps Anx5, anticorps R74653, anticorps LC5, anticorps enx2, anticorps annexin A5, anticorps annexin A5b, anticorps Annexin A5, anticorps annexin A5 L homeolog, anticorps ANXA5, anticorps anxa5b, anticorps anxa5, anticorps Anxa5, anticorps anxa5.L
- Classe de substances
- Chemical
- Sujet
- The protein encoded by ANXA5 belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII.
- Poids moléculaire
- 35 kDa (MW of target protein)
- Pathways
- Apoptose
-