C-Type Lectin Domain Family 4, Member M (CLEC4M) (N-Term) anticorps

N° du produit ABIN630277

Détail du produit

Antigène: C-Type Lectin Domain Family 4, Member M (CLEC4M)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: CLEC4 M antibody was raised against the N terminal of CLEC4

Purification: Purified

Immunogène: CLEC4 M antibody was raised using the N terminal of CLEC4 corresponding to a region with amino acids LVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAV

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CLEC4M Blocking Peptide, catalog no. 33R-5525, is also available for use as a blocking control in assays to test for specificity of this CLEC4M antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLEC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: C-Type Lectin Domain Family 4, Member M (CLEC4M)

Autre désignation: CLEC4M (CLEC4M Produits)

Synonymes: anticorps CD209L, anticorps CD299, anticorps DC-SIGN2, anticorps DC-SIGNR, anticorps DCSIGNR, anticorps HP10347, anticorps L-SIGN, anticorps LSIGN, anticorps CD209B, anticorps C-type lectin domain family 4 member M, anticorps CLEC4M

Sujet: CLEC4M is a type II integral membrane protein that is 77% identical to CD209 antigen, a HIV gp120-binding protein. This protein, like CD209, efficiently binds both intercellular adhesion molecule 3 (ICAM3) and HIV-1 gp120, and enhances HIV-1 infection of T cells.

Poids moléculaire: 44 kDa (MW of target protein)