Indian Hedgehog anticorps
-
- Antigène Voir toutes Indian Hedgehog (IHH) Anticorps
- Indian Hedgehog (IHH)
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Indian Hedgehog est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- IHH antibody was raised using a synthetic peptide corresponding to a region with amino acids AAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIAR
- Top Product
- Discover our top product IHH Anticorps primaire
-
anti-Indian Hedgehog (IHH) (AA 203-411) antibody
IHH Reactivité: Humain ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Indian Hedgehog (IHH) (AA 1-30), (N-Term) antibodyIHH Reactivité: Humain, Souris WB, IHC (p) Hôte: Lapin Polyclonal RB10375 unconjugated
anti-Indian Hedgehog (IHH) (N-Term) antibodyIHH Reactivité: Humain, Souris, Rat, Chien, Cobaye, Boeuf (Vache), Chévre, Cheval, Lapin, Poisson zèbre (Danio rerio) WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Indian Hedgehog (IHH) (AA 45-195) antibodyIHH Reactivité: Humain WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Indian Hedgehog (IHH) antibodyIHH Reactivité: Humain, Souris ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Indian Hedgehog (IHH) (AA 119-217) antibodyIHH Reactivité: Humain WB, ELISA Hôte: Souris Monoclonal 2G9 unconjugated
anti-Indian Hedgehog (IHH) (AA 24-73) antibodyIHH Reactivité: Humain, Souris, Rat, Chien, Cobaye, Roussette (Chauve-souris), Poulet, Singe, Porc, Xenopus laevis WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Indian Hedgehog (IHH) (AA 1-30) antibodyIHH Reactivité: Humain, Souris WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Indian Hedgehog (IHH) (AA 161-260) antibodyIHH Reactivité: Rat ELISA, IHC (p), IF (cc), IF (p), IHC (fro) Hôte: Lapin Polyclonal unconjugated
anti-Indian Hedgehog (IHH) (AA 380-410), (C-Term) antibodyIHH Reactivité: Humain, Rat WB Hôte: Lapin Polyclonal RB51202 unconjugated
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
IHH Blocking Peptide, catalog no. 33R-1064, is also available for use as a blocking control in assays to test for specificity of this IHH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IHH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Indian Hedgehog (IHH)
- Autre désignation
- IHH (IHH Produits)
- Synonymes
- anticorps BDA1, anticorps HHG2, anticorps X-hh, anticorps Xbhh, anticorps bhh, anticorps bhh-a, anticorps IHH, anticorps ehh, anticorps zgc:113262, anticorps indian hedgehog, anticorps Indian hedgehog, anticorps indian hedgehog S homeolog, anticorps Indian hedgehog homolog b, anticorps IHH, anticorps Ihh, anticorps ihh.S, anticorps ihhb
- Sujet
- IHH is an intercellular signal essential for a variety of patterning events during development. It binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. It is implicated in endochondral ossification: may regulate the balance between growth and ossification of the developing bones and induces the expression of parathyroid hormone-related protein (PTHRP).
- Poids moléculaire
- 45 kDa (MW of target protein)
- Pathways
- Signalisation Hedgehog
-
