Indian Hedgehog anticorps

N° du produit ABIN630306

Cet anticorps anti-Indian Hedgehog Polyclonal Lapin (ABIN630306) détecte spécifiquement Indian Hedgehog dans WB et IHC. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour Indian Hedgehog anticorps (ABIN630306)

Antigène: Indian Hedgehog (IHH)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Indian Hedgehog est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-Indian Hedgehog anticorps

Purification: Purified

Immunogène: IHH antibody was raised using a synthetic peptide corresponding to a region with amino acids AAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIAR

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IHH Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this IHH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IHH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Indian Hedgehog

Antigène: Indian Hedgehog (IHH)

Autre désignation: IHH

Sujet: IHH is an intercellular signal essential for a variety of patterning events during development. It binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. It is implicated in endochondral ossification: may regulate the balance between growth and ossification of the developing bones and induces the expression of parathyroid hormone-related protein (PTHRP).

Poids moléculaire: 45 kDa (MW of target protein)

Pathways: Signalisation Hedgehog