SLC22A2 anticorps
-
- Antigène Voir toutes SLC22A2 Anticorps
- SLC22A2 (Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC22A2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- SLC22 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHR
- Top Product
- Discover our top product SLC22A2 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC22A2 Blocking Peptide, catalog no. 33R-6311, is also available for use as a blocking control in assays to test for specificity of this SLC22A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC22A2 (Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2))
- Autre désignation
- SLC22A2 (SLC22A2 Produits)
- Synonymes
- anticorps OCT2, anticorps Oct2, anticorps Orct2, anticorps OCT2r, anticorps rOCT2, anticorps Pou2f2, anticorps OCT2P, anticorps oct1, anticorps wu:fc01b11, anticorps zgc:64076, anticorps slc22a2, anticorps solute carrier family 22 member 2, anticorps solute carrier family 22 (organic cation transporter), member 2, anticorps POU class 2 homeobox 2, anticorps solute carrier family 22 (organic cation transporter), member 2 L homeolog, anticorps SLC22A2, anticorps Slc22a2, anticorps POU2F2, anticorps LOC521027, anticorps slc22a2, anticorps slc22a2.L
- Sujet
- Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. SLC22A2 is one of the three similar cation transporters. SLC22A2 contains twelve putative transmembrane domains and is a plasma integral membrane protein. It is found primarily in the kidney, where it may mediate the first step in cation reabsorption.
- Poids moléculaire
- 62 kDa (MW of target protein)
-