SLC22A2 anticorps

N° du produit ABIN630308

Détail du produit anti-SLC22A2 anticorps

Antigène: SLC22A2 (Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC22A2 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: SLC22 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHR

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC22A2 Blocking Peptide, catalog no. 33R-6311, is also available for use as a blocking control in assays to test for specificity of this SLC22A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC22A2

Antigène: SLC22A2 (Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2))

Autre désignation: SLC22A2 (SLC22A2 Produits)

Synonymes: anticorps OCT2, anticorps Oct2, anticorps Orct2, anticorps OCT2r, anticorps rOCT2, anticorps Pou2f2, anticorps OCT2P, anticorps oct1, anticorps wu:fc01b11, anticorps zgc:64076, anticorps slc22a2, anticorps solute carrier family 22 member 2, anticorps solute carrier family 22 (organic cation transporter), member 2, anticorps POU class 2 homeobox 2, anticorps solute carrier family 22 (organic cation transporter), member 2 L homeolog, anticorps SLC22A2, anticorps Slc22a2, anticorps POU2F2, anticorps LOC521027, anticorps slc22a2, anticorps slc22a2.L

Sujet: Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. SLC22A2 is one of the three similar cation transporters. SLC22A2 contains twelve putative transmembrane domains and is a plasma integral membrane protein. It is found primarily in the kidney, where it may mediate the first step in cation reabsorption.

Poids moléculaire: 62 kDa (MW of target protein)