MUC1 anticorps (C-Term)
-
- Antigène Voir toutes MUC1 Anticorps
- MUC1 (Mucin 1 (MUC1))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MUC1 est non-conjugé
-
Application
- Immunohistochemistry (IHC), Western Blotting (WB)
- Specificité
- MUC1 antibody was raised against the C terminal of MUC1
- Purification
- Purified
- Immunogène
- MUC1 antibody was raised using the C terminal of MUC1 corresponding to a region with amino acids RRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGN
- Top Product
- Discover our top product MUC1 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MUC1 Blocking Peptide, catalog no. 33R-8143, is also available for use as a blocking control in assays to test for specificity of this MUC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MUC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MUC1 (Mucin 1 (MUC1))
- Autre désignation
- MUC1 (MUC1 Produits)
- Synonymes
- anticorps CA 15-3, anticorps CD227, anticorps EMA, anticorps H23AG, anticorps KL-6, anticorps MAM6, anticorps MCKD1, anticorps MUC-1, anticorps MUC-1/SEC, anticorps MUC-1/X, anticorps MUC1/ZD, anticorps PEM, anticorps PEMT, anticorps PUM, anticorps Muc-1, anticorps mucin 1, cell surface associated, anticorps mucin 1, transmembrane, anticorps MUC1, anticorps Muc1
- Sujet
- MUC1 is a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas.
- Poids moléculaire
- 22 kDa (MW of target protein)
- Pathways
- Negative Regulation of intrinsic apoptotic Signaling
-