FNDC3B anticorps (N-Term)

N° du produit ABIN630408

Détail du produit anti-FNDC3B anticorps

Antigène: FNDC3B (Fibronectin Type III Domain Containing 3B (FNDC3B))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FNDC3B est non-conjugé

Application: Western Blotting (WB)

Specificité: FNDC3 B antibody was raised against the N terminal of FNDC3

Purification: Purified

Immunogène: FNDC3 B antibody was raised using the N terminal of FNDC3 corresponding to a region with amino acids RARSSPKSNDSDLQEYELEVKRVQDILSGIEKPQVSNIQARAVVLSWAPP

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FNDC3B Blocking Peptide, catalog no. 33R-7822, is also available for use as a blocking control in assays to test for specificity of this FNDC3B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FNDC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FNDC3B

Antigène: FNDC3B (Fibronectin Type III Domain Containing 3B (FNDC3B))

Autre désignation: FNDC3B (FNDC3B Produits)

Synonymes: anticorps FAD104, anticorps PRO4979, anticorps YVTM2421, anticorps 1600019O04Rik, anticorps AW550168, anticorps Fad104, anticorps mKIAA4164, anticorps RGD1311673, anticorps FNDC3B, anticorps DKFZp469D136, anticorps fibronectin type III domain containing 3B, anticorps FNDC3B, anticorps Fndc3b, anticorps fndc3b

Sujet: FNDC3B may be a positive regulator of adipogenesis.

Poids moléculaire: 44 kDa (MW of target protein)

Pathways: Positive Regulation of fat Cell Differentiation