TGFBR2 anticorps

N° du produit ABIN630421

Détail du produit anti-TGFBR2 anticorps

Antigène: TGFBR2 (Transforming Growth Factor, beta Receptor II (70/80kDa) (TGFBR2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TGFBR2 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: TGFBR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKDEIICPSCNRT

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TGFBR2 Blocking Peptide, catalog no. 33R-6065, is also available for use as a blocking control in assays to test for specificity of this TGFBR2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGFBR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TGFBR2

Antigène: TGFBR2 (Transforming Growth Factor, beta Receptor II (70/80kDa) (TGFBR2))

Autre désignation: TGFBR2 (TGFBR2 Produits)

Synonymes: anticorps AAT3, anticorps FAA3, anticorps LDS1B, anticorps LDS2B, anticorps MFS2, anticorps RIIC, anticorps TAAD2, anticorps TGFR-2, anticorps TGFbeta-RII, anticorps 1110020H15Rik, anticorps AU042018, anticorps DNIIR, anticorps RIIDN, anticorps TBR-II, anticorps TbetaR-II, anticorps TbetaRII, anticorps TGFBR2, anticorps TBETA-RII, anticorps TGFBRII, anticorps TGF-beta 2, anticorps Tgfbr2T, anticorps cb537, anticorps tgfbr2, anticorps wu:fj05c10, anticorps zgc:110498, anticorps transforming growth factor beta receptor 2, anticorps transforming growth factor, beta receptor II, anticorps transforming growth factor, beta receptor 2, anticorps transforming growth factor beta receptor 2b, anticorps TGFBR2, anticorps Tgfbr2, anticorps tgfbr2b

Sujet: TGFBR2 is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. The protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in its gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors.

Poids moléculaire: 62 kDa (MW of target protein)