NR1D1 anticorps (Middle Region)

N° du produit ABIN630499

Détail du produit anti-NR1D1 anticorps

Antigène: NR1D1 (Nuclear Receptor Subfamily 1, Group D, Member 1 (NR1D1))

Épitope: Middle Region

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NR1D1 est non-conjugé

Application: Western Blotting (WB)

Specificité: NR1 D1 antibody was raised against the middle region of NR1 1

Purification: Affinity purified

Immunogène: NR1 D1 antibody was raised using the middle region of NR1 1 corresponding to a region with amino acids SQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NR1D1 Blocking Peptide, catalog no. 33R-8729, is also available for use as a blocking control in assays to test for specificity of this NR1D1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NR1D1

Antigène: NR1D1 (Nuclear Receptor Subfamily 1, Group D, Member 1 (NR1D1))

Autre désignation: NR1D1 (NR1D1 Produits)

Synonymes: anticorps MGC82865, anticorps MGC82881, anticorps Eip75B, anticorps EAR1, anticorps THRA1, anticorps THRAL, anticorps ear-1, anticorps hRev, anticorps A530070C09Rik, anticorps R75201, anticorps REV-ERBAALPHA, anticorps nuclear receptor subfamily 1 group D member 1 L homeolog, anticorps nuclear receptor subfamily 1, group d, member 1, anticorps nuclear receptor subfamily 1 group D member 1, anticorps nuclear receptor subfamily 1, group D, member 1, anticorps nr1d1.L, anticorps nr1d1, anticorps NR1D1, anticorps Nr1d1

Sujet: NR1D1 belongs to the nuclear hormone receptor family, NR1 subfamily. It contains 1 nuclear receptor DNA-binding domain. NR1D1 functions as a constitutive transcriptional repressor. It is a possible receptor for triiodothyronine.

Poids moléculaire: 67 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Cellular Response to Molecule of Bacterial Origin, Regulation of Lipid Metabolism by PPARalpha