TFAM anticorps (Middle Region)
-
- Antigène Voir toutes TFAM Anticorps
- TFAM (Transcription Factor A, Mitochondrial (TFAM))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TFAM est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TFAM antibody was raised against the middle region of TFAM
- Purification
- Affinity purified
- Immunogène
- TFAM antibody was raised using the middle region of TFAM corresponding to a region with amino acids LGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYI
- Top Product
- Discover our top product TFAM Anticorps primaire
-
anti-Transcription Factor A, Mitochondrial (TFAM) (N-Term) antibody
TFAM Reactivité: Humain, Souris, Lapin, Boeuf (Vache), Chien, Cobaye, Porc, Cheval WB Hôte: Lapin Polyclonal unconjugated
anti-Transcription Factor A, Mitochondrial (TFAM) (AA 43-243) antibodyTFAM Reactivité: Souris WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Transcription Factor A, Mitochondrial (TFAM) (AA 216-246), (C-Term) antibodyTFAM Reactivité: Humain WB, IHC (p), FACS Hôte: Lapin Polyclonal RB27631 unconjugated
anti-Transcription Factor A, Mitochondrial (TFAM) (AA 1-220) antibodyTFAM Reactivité: Humain WB, IHC, IF, ChIP Hôte: Lapin Polyclonal unconjugated
anti-Transcription Factor A, Mitochondrial (TFAM) antibodyKO Validated TFAM Reactivité: Humain WB, IF, IP, ICC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Transcription Factor A, Mitochondrial (TFAM) (AA 1-246) antibodyTFAM Reactivité: Humain WB, IF, IHC (p) Hôte: Souris Polyclonal unconjugated
anti-Transcription Factor A, Mitochondrial (TFAM) (AA 227-246), (C-Term) antibodyTFAM Reactivité: Humain WB, ICC, IHC (p), IHC (fro) Hôte: Lapin Polyclonal unconjugated
anti-Transcription Factor A, Mitochondrial (TFAM) (AA 1-246) antibodyTFAM Reactivité: Humain WB, IP Hôte: Lapin Polyclonal unconjugated
anti-Transcription Factor A, Mitochondrial (TFAM) antibodyTFAM Reactivité: Humain WB, IHC, IF, ChIP Hôte: Lapin Monoclonal unconjugated
anti-Transcription Factor A, Mitochondrial (TFAM) (AA 216-246) antibodyTFAM Reactivité: Humain WB, IHC, ELISA, IF, FACS Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TFAM Blocking Peptide, catalog no. 33R-4982, is also available for use as a blocking control in assays to test for specificity of this TFAM antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TFAM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TFAM (Transcription Factor A, Mitochondrial (TFAM))
- Autre désignation
- TFAM (TFAM Produits)
- Synonymes
- anticorps tcf6, anticorps mttf1, anticorps mttfa, anticorps tcf6l1, anticorps tcf6l2, anticorps tcf6l3, anticorps mttfa-A, anticorps xl-mtTFA, anticorps MGC153358, anticorps zgc:153358, anticorps MTTF1, anticorps MTTFA, anticorps TCF6, anticorps TCF6L1, anticorps TCF6L2, anticorps TCF6L3, anticorps AI661103, anticorps Hmgts, anticorps mtTFA, anticorps tsHMG, anticorps Mttfa, anticorps transcription factor A, mitochondrial, anticorps transcription factor A, mitochondrial L homeolog, anticorps TFAM, anticorps tfam.L, anticorps tfam, anticorps Tfam
- Sujet
- TFAM is a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication.
- Poids moléculaire
- 28 kDa (MW of target protein)
- Pathways
- Chromatin Binding
-
