GBP4 anticorps (Middle Region)

N° du produit ABIN630525

Détail du produit anti-GBP4 anticorps

Antigène: GBP4 (Guanylate Binding Protein 4 (GBP4))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GBP4 est non-conjugé

Application: Western Blotting (WB)

Specificité: GBP4 antibody was raised against the middle region of GBP4

Purification: Affinity purified

Immunogène: GBP4 antibody was raised using the middle region of GBP4 corresponding to a region with amino acids NAVTALAQLENPAAVQRAADHYSQQMAQQLRLPTDTLQELLDVHAACERE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GBP4 Blocking Peptide, catalog no. 33R-6647, is also available for use as a blocking control in assays to test for specificity of this GBP4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GBP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GBP4

Antigène: GBP4 (Guanylate Binding Protein 4 (GBP4))

Autre désignation: GBP4 (GBP4 Produits)

Synonymes: anticorps AW228052, anticorps Mag-2, anticorps Mpa-2, anticorps Mpa2, anticorps mKIAA4245, anticorps Gbp3, anticorps MGC108424, anticorps GBP4, anticorps Gbp4, anticorps si:ch211-250m6.1, anticorps si:dkey-61p9.3, anticorps gbp4, anticorps gbp4.L, anticorps mpa2, anticorps guanylate binding protein 4, anticorps guanylate-binding protein 4-like, anticorps guanylate-binding protein 4, anticorps guanylate binding protein 4 S homeolog, anticorps Gbp4, anticorps GBP4, anticorps gbp4, anticorps GBP4L, anticorps LOC612426, anticorps LOC100713243, anticorps gbp4.S

Sujet: GBP4 belongs to the GBP family. It binds GTP, GDP and GMP. Hydrolyzes GTP very efficiently, GDP rather than GMP is the major reaction product. GBP4 plays a role in erythroid differentiation.

Poids moléculaire: 45 kDa (MW of target protein)