PSMG1 anticorps

N° du produit ABIN630540

Détail du produit anti-PSMG1 anticorps

Antigène: PSMG1 (Proteasome (Prosome, Macropain) Assembly Chaperone 1 (PSMG1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSMG1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PSMG1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PSMG1 Blocking Peptide, catalog no. 33R-9697, is also available for use as a blocking control in assays to test for specificity of this PSMG1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PSMG1

Antigène: PSMG1 (Proteasome (Prosome, Macropain) Assembly Chaperone 1 (PSMG1))

Autre désignation: PSMG1 (PSMG1 Produits)

Synonymes: anticorps DSCR2, anticorps dscr2, anticorps zgc:91806, anticorps wu:fl12g04, anticorps wu:fu18c08, anticorps PSMG1, anticorps pac1, anticorps c21lrp, anticorps lrpc21, anticorps DDBDRAFT_0206024, anticorps DDBDRAFT_0304546, anticorps DDB_0206024, anticorps DDB_0304546, anticorps C21LRP, anticorps LRPC21, anticorps PAC-1, anticorps PAC1, anticorps AW552102, anticorps Dscr2, anticorps proteasome assembly chaperone 1, anticorps proteasome (prosome, macropain) assembly chaperone 1, anticorps proteasome (prosome, macropain) assembly chaperone 1 L homeolog, anticorps PSMG1, anticorps psmg1, anticorps psmg1.L, anticorps psmG1, anticorps Psmg1

Sujet: PSMG1 is a chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG2. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization.

Poids moléculaire: 33 kDa (MW of target protein)