DCAF4 anticorps (Middle Region)
-
- Antigène Voir toutes DCAF4 Anticorps
- DCAF4 (DDB1 and CUL4 Associated Factor 4 (DCAF4))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DCAF4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- WDR21 A antibody was raised against the middle region of WDR21
- Purification
- Affinity purified
- Immunogène
- WDR21 A antibody was raised using the middle region of WDR21 corresponding to a region with amino acids GHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKAT
- Top Product
- Discover our top product DCAF4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
WDR21A Blocking Peptide, catalog no. 33R-3313, is also available for use as a blocking control in assays to test for specificity of this WDR21A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR20 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DCAF4 (DDB1 and CUL4 Associated Factor 4 (DCAF4))
- Autre désignation
- WDR21A (DCAF4 Produits)
- Synonymes
- anticorps Wdr21, anticorps 1110018E21Rik, anticorps WDR21, anticorps WDR21A, anticorps DDB1 and CUL4 associated factor 4, anticorps Dcaf4, anticorps DCAF4
- Sujet
- WDR21A is a WD repeat-containing protein. The function of WDR21A remains unknown.
- Poids moléculaire
- 43 kDa (MW of target protein)
-