IMPDH1 anticorps
-
- Antigène Voir toutes IMPDH1 Anticorps
- IMPDH1 (Inosine 5'-Phosphate Dehydrogenase 1 (IMPDH1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IMPDH1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- IMPDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTRE
- Top Product
- Discover our top product IMPDH1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
IMPDH1 Blocking Peptide, catalog no. 33R-4468, is also available for use as a blocking control in assays to test for specificity of this IMPDH1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMPDH1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IMPDH1 (Inosine 5'-Phosphate Dehydrogenase 1 (IMPDH1))
- Autre désignation
- IMPDH1 (IMPDH1 Produits)
- Synonymes
- anticorps IMPD, anticorps IMPD1, anticorps LCA11, anticorps RP10, anticorps sWSS2608, anticorps B930086D20Rik, anticorps IMPD 1, anticorps IMPDH 1, anticorps D3, anticorps IMPD 1b, anticorps IMPDH 1b, anticorps IMPDH1, anticorps id:ibd5035, anticorps si:dkey-31f5.7, anticorps wu:fa09h11, anticorps wu:fa99c03, anticorps zgc:113446, anticorps imp, anticorps imp1, anticorps imp2, anticorps IMPD 1a, anticorps IMPDH 1a, anticorps zgc:91911, anticorps inosine monophosphate dehydrogenase 1, anticorps inosine-5'-monophosphate dehydrogenase 1, anticorps IMP (inosine 5'-monophosphate) dehydrogenase 1b, anticorps IMP (inosine 5'-monophosphate) dehydrogenase 1, anticorps IMP (inosine 5'-monophosphate) dehydrogenase 1a, anticorps IMPDH1, anticorps Impdh1, anticorps LOC100442769, anticorps impdh1, anticorps impdh1b, anticorps impdh1.L, anticorps impdh1a
- Sujet
- IMPDH1 acts as a homotetramer to regulate cell growth. It is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5'-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10).
- Poids moléculaire
- 62 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-