IMPDH1 anticorps

N° du produit ABIN630628

Détail du produit anti-IMPDH1 anticorps

Antigène: IMPDH1 (Inosine 5'-Phosphate Dehydrogenase 1 (IMPDH1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IMPDH1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: IMPDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTRE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IMPDH1 Blocking Peptide, catalog no. 33R-4468, is also available for use as a blocking control in assays to test for specificity of this IMPDH1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMPDH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IMPDH1

Antigène: IMPDH1 (Inosine 5'-Phosphate Dehydrogenase 1 (IMPDH1))

Autre désignation: IMPDH1 (IMPDH1 Produits)

Synonymes: anticorps IMPD, anticorps IMPD1, anticorps LCA11, anticorps RP10, anticorps sWSS2608, anticorps B930086D20Rik, anticorps IMPD 1, anticorps IMPDH 1, anticorps D3, anticorps IMPD 1b, anticorps IMPDH 1b, anticorps IMPDH1, anticorps id:ibd5035, anticorps si:dkey-31f5.7, anticorps wu:fa09h11, anticorps wu:fa99c03, anticorps zgc:113446, anticorps imp, anticorps imp1, anticorps imp2, anticorps IMPD 1a, anticorps IMPDH 1a, anticorps zgc:91911, anticorps inosine monophosphate dehydrogenase 1, anticorps inosine-5'-monophosphate dehydrogenase 1, anticorps IMP (inosine 5'-monophosphate) dehydrogenase 1b, anticorps IMP (inosine 5'-monophosphate) dehydrogenase 1, anticorps IMP (inosine 5'-monophosphate) dehydrogenase 1a, anticorps IMPDH1, anticorps Impdh1, anticorps LOC100442769, anticorps impdh1, anticorps impdh1b, anticorps impdh1.L, anticorps impdh1a

Sujet: IMPDH1 acts as a homotetramer to regulate cell growth. It is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5'-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10).

Poids moléculaire: 62 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process