PDE1C anticorps (Middle Region)

N° du produit ABIN630646

Cet anticorps Lapin Polyclonal détecte spécifiquement PDE1C dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour PDE1C anticorps (Middle Region) (ABIN630646)

Antigène: PDE1C (phosphodiesterase 1C, Calmodulin-Dependent 70kDa (PDE1C))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDE1C est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PDE1C anticorps

Épitope: Middle Region

Specificité: PDE1 C antibody was raised against the middle region of PDE1

Purification: Affinity purified

Immunogène: PDE1 C antibody was raised using the middle region of PDE1 corresponding to a region with amino acids IDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDE1C Blocking Peptide, (ABIN939298), is also available for use as a blocking control in assays to test for specificity of this PDE1C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDE1C

Antigène: PDE1C (phosphodiesterase 1C, Calmodulin-Dependent 70kDa (PDE1C))

Autre désignation: PDE1C

Sujet: Cyclic nucleotide phosphodiesterases (PDEs) catalyze hydrolysis of the cyclic nucleotides cAMP and cGMP to the corresponding nucleoside 5-prime-monophosphates. Mammalian PDEs have been classified into several families based on their biochemical properties

Poids moléculaire: 72 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Negative Regulation of Hormone Secretion, cAMP Metabolic Process, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma