PDE1C anticorps (Middle Region)
-
- Antigène Voir toutes PDE1C Anticorps
- PDE1C (phosphodiesterase 1C, Calmodulin-Dependent 70kDa (PDE1C))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PDE1C est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PDE1 C antibody was raised against the middle region of PDE1
- Purification
- Affinity purified
- Immunogène
- PDE1 C antibody was raised using the middle region of PDE1 corresponding to a region with amino acids IDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR
- Top Product
- Discover our top product PDE1C Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PDE1C Blocking Peptide, catalog no. 33R-3912, is also available for use as a blocking control in assays to test for specificity of this PDE1C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PDE1C (phosphodiesterase 1C, Calmodulin-Dependent 70kDa (PDE1C))
- Autre désignation
- PDE1C (PDE1C Produits)
- Synonymes
- anticorps CG14940, anticorps CG14942, anticorps CG14943, anticorps CG14944, anticorps CG31757, anticorps CG31758, anticorps CG42325, anticorps CG44007, anticorps Dmel\\CG44007, anticorps Dmel_CG14940, anticorps Dmel_CG14943, anticorps Dmel_CG14944, anticorps Dmel_CG31757, anticorps Dmel_CG31758, anticorps Dmel_CG42325, anticorps PDE1C, anticorps PDE1c, anticorps GB13690, anticorps Hcam3, anticorps Phosphodiesterase 1c, anticorps phosphodiesterase 1C, anticorps calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A, anticorps calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C, anticorps phosphodiesterase 1C, calmodulin-dependent b, anticorps Pde1c, anticorps PDE1C, anticorps LOC724389, anticorps LOC100019026, anticorps pde1cb
- Sujet
- Cyclic nucleotide phosphodiesterases (PDEs) catalyze hydrolysis of the cyclic nucleotides cAMP and cGMP to the corresponding nucleoside 5-prime-monophosphates. Mammalian PDEs have been classified into several families based on their biochemical properties
- Poids moléculaire
- 72 kDa (MW of target protein)
- Pathways
- EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Negative Regulation of Hormone Secretion, cAMP Metabolic Process, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma
-