ECHDC1 anticorps (Middle Region)

N° du produit ABIN630734

Détail du produit anti-ECHDC1 anticorps

Antigène: ECHDC1 (Enoyl CoA Hydratase Domain Containing 1 (ECHDC1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ECHDC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ECHDC1 antibody was raised against the middle region of ECHDC1

Purification: Affinity purified

Immunogène: ECHDC1 antibody was raised using the middle region of ECHDC1 corresponding to a region with amino acids GVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ECHDC1 Blocking Peptide, catalog no. 33R-3646, is also available for use as a blocking control in assays to test for specificity of this ECHDC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ECHDC1

Antigène: ECHDC1 (Enoyl CoA Hydratase Domain Containing 1 (ECHDC1))

Autre désignation: ECHDC1 (ECHDC1 Produits)

Synonymes: anticorps MMCD, anticorps dJ351K20.2, anticorps 1700028A24Rik, anticorps AI314462, anticorps AI930038, anticorps D10Ertd667e, anticorps MGC110060, anticorps zgc:110060, anticorps ethylmalonyl-CoA decarboxylase 1, anticorps ethylmalonyl-CoA decarboxylase 1 L homeolog, anticorps enoyl Coenzyme A hydratase domain containing 1, anticorps enoyl CoA hydratase domain containing 1, anticorps echdc1, anticorps ECHDC1, anticorps echdc1.L, anticorps Echdc1

Sujet: ECHDC1 belongs to the enoyl-CoA hydratase/isomerase family. The exact function of ECHDC1 remains unknown.

Poids moléculaire: 33 kDa (MW of target protein)