ECHDC1 anticorps (Middle Region)
-
- Antigène Voir toutes ECHDC1 Anticorps
- ECHDC1 (Enoyl CoA Hydratase Domain Containing 1 (ECHDC1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ECHDC1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ECHDC1 antibody was raised against the middle region of ECHDC1
- Purification
- Affinity purified
- Immunogène
- ECHDC1 antibody was raised using the middle region of ECHDC1 corresponding to a region with amino acids GVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDG
- Top Product
- Discover our top product ECHDC1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ECHDC1 Blocking Peptide, catalog no. 33R-3646, is also available for use as a blocking control in assays to test for specificity of this ECHDC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHDC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ECHDC1 (Enoyl CoA Hydratase Domain Containing 1 (ECHDC1))
- Autre désignation
- ECHDC1 (ECHDC1 Produits)
- Synonymes
- anticorps MMCD, anticorps dJ351K20.2, anticorps 1700028A24Rik, anticorps AI314462, anticorps AI930038, anticorps D10Ertd667e, anticorps MGC110060, anticorps zgc:110060, anticorps ethylmalonyl-CoA decarboxylase 1, anticorps ethylmalonyl-CoA decarboxylase 1 L homeolog, anticorps enoyl Coenzyme A hydratase domain containing 1, anticorps enoyl CoA hydratase domain containing 1, anticorps echdc1, anticorps ECHDC1, anticorps echdc1.L, anticorps Echdc1
- Sujet
- ECHDC1 belongs to the enoyl-CoA hydratase/isomerase family. The exact function of ECHDC1 remains unknown.
- Poids moléculaire
- 33 kDa (MW of target protein)
-