EPH Receptor A5 anticorps (Middle Region)

N° du produit ABIN630792

Détail du produit anti-EPH Receptor A5 anticorps

Antigène: EPH Receptor A5 (EPHA5)

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EPH Receptor A5 est non-conjugé

Application: Western Blotting (WB)

Specificité: Eph Receptor A5 antibody was raised against the middle region of EPHA5

Purification: Affinity purified

Immunogène: Eph Receptor A5 antibody was raised using the middle region of EPHA5 corresponding to a region with amino acids SDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Eph Receptor A5 Blocking Peptide, catalog no. 33R-8364, is also available for use as a blocking control in assays to test for specificity of this Eph Receptor A5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPHA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EPH Receptor A5

Antigène: EPH Receptor A5 (EPHA5)

Autre désignation: Eph Receptor A5 (EPHA5 Produits)

Synonymes: anticorps CEK7, anticorps EHK-1, anticorps EHK1, anticorps EK7, anticorps HEK7, anticorps TYRO4, anticorps AI854630, anticorps AW125296, anticorps Cek7, anticorps Ehk1, anticorps Els1, anticorps Hek7, anticorps Rek7, anticorps bsk, anticorps Els1., anticorps EPHA5, anticorps EPH receptor A5, anticorps Eph receptor A5, anticorps EPHA5, anticorps epha5, anticorps Epha5

Sujet: EPHA5 belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Two transcript variants encoding different isoforms have been found for this gene.

Poids moléculaire: 114 kDa (MW of target protein)

Pathways: Signalisation RTK