PIWIL4 anticorps

N° du produit ABIN630849

Détail du produit anti-PIWIL4 anticorps

Antigène: PIWIL4 (Piwi-Like 4 (PIWIL4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PIWIL4 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PIWIL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PIWIL4 Blocking Peptide, catalog no. 33R-8482, is also available for use as a blocking control in assays to test for specificity of this PIWIL4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIWIL4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PIWIL4

Antigène: PIWIL4 (Piwi-Like 4 (PIWIL4))

Autre désignation: PIWIL4 (PIWIL4 Produits)

Synonymes: anticorps HIWI2, anticorps MIWI2, anticorps 9230101H05Rik, anticorps Miwi2, anticorps piwi like RNA-mediated gene silencing 4, anticorps piwi-like RNA-mediated gene silencing 4, anticorps PIWIL4, anticorps Piwil4

Sujet: PIWIL4 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells.

Poids moléculaire: 96 kDa (MW of target protein)