SPNS2 anticorps
-
- Antigène Voir toutes SPNS2 Anticorps
- SPNS2 (Spinster Homolog 2 (SPNS2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SPNS2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SPNS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY
- Top Product
- Discover our top product SPNS2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SPNS2 Blocking Peptide, catalog no. 33R-7255, is also available for use as a blocking control in assays to test for specificity of this SPNS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPNS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SPNS2 (Spinster Homolog 2 (SPNS2))
- Autre désignation
- SPNS2 (SPNS2 Produits)
- Synonymes
- anticorps fi20h04, anticorps si:dkey-7b17.4, anticorps toh, anticorps wu:fi20h04, anticorps DKFZp459J1933, anticorps spinster homolog 2 (Drosophila), anticorps sphingolipid transporter 2, anticorps spinster homolog 2, anticorps SPNS2, anticorps spns2, anticorps Spns2
- Sujet
- SPNS2 is the sphingolipid transporter required for migration of myocardial precursors. SPNS2 transports sphingosine 1-phosphate (S1P), a secreted lipid mediator that plays critical roles in cardiovascular, immunological, and neural development and function. SPNS2 mediates the export of S1P from cells in the extraembryonic yolk syncytial layer (YSL), thereby regulating myocardial precursor migration.
- Poids moléculaire
- 60 kDa (MW of target protein)
-