PDE4B anticorps

N° du produit ABIN630858

Détail du produit anti-PDE4B anticorps

Antigène: PDE4B (phosphodiesterase 4B, cAMP-Specific (PDE4B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDE4B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PDE4 B antibody was raised using a synthetic peptide corresponding to a region with amino acids QDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEED

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDE4B Blocking Peptide, catalog no. 33R-7502, is also available for use as a blocking control in assays to test for specificity of this PDE4B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDE4B

Antigène: PDE4B (phosphodiesterase 4B, cAMP-Specific (PDE4B))

Autre désignation: PDE4B (PDE4B Produits)

Synonymes: anticorps dpde4, anticorps pde4b5, anticorps pdeivb, anticorps Dpde4, anticorps R74983, anticorps dunce, anticorps PDE4/IVb, anticorps Pde4B1, anticorps Pde4B2, anticorps Pde4B3, anticorps Pde4B4, anticorps DPDE4, anticorps PDE4B5, anticorps PDEIVB, anticorps phosphodiesterase 4B, anticorps phosphodiesterase 4B, cAMP specific, anticorps phosphodiesterase 4B S homeolog, anticorps pde4b, anticorps PDE4B, anticorps Pde4b, anticorps pde4b.S

Sujet: This gene is a member of the type IV, cyclic AMP (cAMP)-specific, cyclic nucleotide phosphodiesterase (PDE) family. Cyclic nucleotides are important second messengers that regulate and mediate a number of cellular responses to extracellular signals, such as hormones, light, and neurotransmitters. The cyclic nucleotide phosphodiesterases (PDEs) regulate the cellular concentrations of cyclic nucleotides and thereby play a role in signal transduction.

Poids moléculaire: 64 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin, cAMP Metabolic Process, Myometrial Relaxation and Contraction