XRCC4 anticorps (Middle Region)

N° du produit ABIN630879

Détail du produit anti-XRCC4 anticorps

Antigène: XRCC4 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 4 (XRCC4))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp XRCC4 est non-conjugé

Application: Western Blotting (WB)

Specificité: XRCC4 antibody was raised against the middle region of XRCC4

Purification: Affinity purified

Immunogène: XRCC4 antibody was raised using the middle region of XRCC4 corresponding to a region with amino acids LQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

XRCC4 Blocking Peptide, catalog no. 33R-5319, is also available for use as a blocking control in assays to test for specificity of this XRCC4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XRCC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur XRCC4

Antigène: XRCC4 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 4 (XRCC4))

Autre désignation: XRCC4 (XRCC4 Produits)

Synonymes: anticorps zgc:73312, anticorps MGC81443, anticorps homolog of human DNA ligase iv-binding protein XRCC4, anticorps 2310057B22Rik, anticorps AW413319, anticorps AW545101, anticorps X-ray repair cross complementing 4, anticorps X-ray repair complementing defective repair in Chinese hamster cells 4, anticorps X-ray repair complementing defective repair in Chinese hamster cells 4 L homeolog, anticorps DNA ligase IV-binding protein, anticorps XRCC4, anticorps xrcc4, anticorps xrcc4.L, anticorps Xrcc4

Sujet: XRCC4 functions together with DNA ligase IV and the DNA-dependent protein kinase in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. The non-homologous end-joining pathway is required both for normal development and for suppression of tumors. This gene functionally complements XR-1 Chinese hamster ovary cell mutant, which is impaired in DNA double-strand breaks produced by ionizing radiation and restriction enzymes.

Poids moléculaire: 38 kDa (MW of target protein)

Pathways: Réparation de l'ADN, Production of Molecular Mediator of Immune Response