MYL6 anticorps (N-Term)

N° du produit ABIN630884

Détail du produit anti-MYL6 anticorps

Antigène: MYL6 (Myosin Light Chain 6, Alkali, Smooth Muscle and Non Muscle (MYL6))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MYL6 est non-conjugé

Application: Western Blotting (WB)

Specificité: MYL6 antibody was raised against the N terminal of MYL6

Purification: Affinity purified

Immunogène: MYL6 antibody was raised using the N terminal of MYL6 corresponding to a region with amino acids CDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MYL6 Blocking Peptide, catalog no. 33R-1660, is also available for use as a blocking control in assays to test for specificity of this MYL6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYL6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MYL6

Antigène: MYL6 (Myosin Light Chain 6, Alkali, Smooth Muscle and Non Muscle (MYL6))

Autre désignation: MYL6 (MYL6 Produits)

Synonymes: anticorps ESMLC, anticorps LC17, anticorps LC17-GI, anticorps LC17-NM, anticorps LC17A, anticorps LC17B, anticorps MLC-3, anticorps MLC1SM, anticorps MLC3NM, anticorps MLC3SM, anticorps zgc:103624, anticorps MLC3nm, anticorps Myln, anticorps myosin light chain 6, anticorps myosin, light chain 6, alkali, smooth muscle and non-muscle, anticorps myosin light chain 6 L homeolog, anticorps myosin, light polypeptide 6, alkali, smooth muscle and non-muscle, anticorps MYL6, anticorps Myl6, anticorps myl6, anticorps myl6.L

Sujet: MYL6 contains 3 EF-hand domains. It is the regulatory light chain of myosin. MYL6 does not bind calcium. Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene.

Poids moléculaire: 17 kDa (MW of target protein)