CKMT2 anticorps
-
- Antigène Voir toutes CKMT2 Anticorps
- CKMT2 (Creatine Kinase, Mitochondrial 2 (Sarcomeric) (CKMT2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CKMT2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- CKMT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGKK
- Top Product
- Discover our top product CKMT2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CKMT2 Blocking Peptide, catalog no. 33R-4160, is also available for use as a blocking control in assays to test for specificity of this CKMT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CKMT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CKMT2 (Creatine Kinase, Mitochondrial 2 (Sarcomeric) (CKMT2))
- Autre désignation
- CKMT2 (CKMT2 Produits)
- Synonymes
- anticorps 2300008A19Rik, anticorps ScCKmit, anticorps MIBCK, anticorps SMTCK, anticorps ckmt2-2, anticorps zgc:73059, anticorps CKMT2, anticorps Mib-CK, anticorps S-MtCK, anticorps creatine kinase, mitochondrial 2, anticorps creatine kinase, mitochondrial 2 (sarcomeric), anticorps creatine kinase, mitochondrial 2b (sarcomeric), anticorps CKMT2, anticorps ckmt2, anticorps Ckmt2, anticorps ckmt2b
- Sujet
- Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase.
- Poids moléculaire
- 43 kDa (MW of target protein)
-