UBE4B anticorps

N° du produit ABIN630903

Détail du produit anti-UBE4B anticorps

Antigène: UBE4B (Ubiquitin Conjugation Factor E4 B (UBE4B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBE4B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: UBE4 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SPMFCSVASFGASSLSSLYESSPAPTPSFWSSVPVMGPSLASPSRAASQL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UBE4B Blocking Peptide, catalog no. 33R-8685, is also available for use as a blocking control in assays to test for specificity of this UBE4B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBE4B

Antigène: UBE4B (Ubiquitin Conjugation Factor E4 B (UBE4B))

Autre désignation: UBE4B (UBE4B Produits)

Synonymes: anticorps ufd2a, anticorps E4, anticorps HDNB1, anticorps UBOX3, anticorps UFD2, anticorps UFD2A, anticorps 4930551I19Rik, anticorps 4933406G05Rik, anticorps AU014668, anticorps D4Bwg0973e, anticorps UFD2a, anticorps Ufd2p, anticorps mKIAA0684, anticorps ubiquitination factor E4B, anticorps putative ubiquitin conjugation factor E4 B, anticorps ubiquitin conjugation factor E4 B, anticorps ubiquitination factor E4B, UFD2 homolog (S. cerevisiae), anticorps Ube4b, anticorps LINJ_30_1070, anticorps LBRM_30_1130, anticorps Tsp_12732, anticorps Tsp_01624, anticorps ube4b, anticorps UBE4B

Sujet: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE4B is an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. The gene that encodes the protein is also the strongest candidate in the neuroblastoma tumor suppressor genes.

Poids moléculaire: 146 kDa (MW of target protein)