UBE4B anticorps

N° du produit ABIN630903

Cet anticorps anti-UBE4B Polyclonal Lapin (ABIN630903) détecte spécifiquement UBE4B dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour UBE4B anticorps (ABIN630903)

Antigène: UBE4B (Ubiquitin Conjugation Factor E4 B (UBE4B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBE4B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UBE4B anticorps

Purification: Affinity purified

Immunogène: UBE4 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SPMFCSVASFGASSLSSLYESSPAPTPSFWSSVPVMGPSLASPSRAASQL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UBE4B Blocking Peptide, (ABIN5616881), is also available for use as a blocking control in assays to test for specificity of this UBE4B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBE4B

Antigène: UBE4B (Ubiquitin Conjugation Factor E4 B (UBE4B))

Autre désignation: UBE4B

Sujet: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE4B is an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. The gene that encodes the protein is also the strongest candidate in the neuroblastoma tumor suppressor genes.

Poids moléculaire: 146 kDa (MW of target protein)