PSMB3 anticorps

N° du produit ABIN630921

Détail du produit anti-PSMB3 anticorps

Antigène: PSMB3 (Proteasome Subunit beta 3 (PSMB3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSMB3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PSMB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PSMB3 Blocking Peptide, catalog no. 33R-5230, is also available for use as a blocking control in assays to test for specificity of this PSMB3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PSMB3

Antigène: PSMB3 (Proteasome Subunit beta 3 (PSMB3))

Autre désignation: PSMB3 (PSMB3 Produits)

Synonymes: anticorps HC10-II, anticorps AL033320, anticorps C10-II, anticorps PSB3, anticorps psmb3, anticorps wu:fb11d10, anticorps wu:fu88b08, anticorps zgc:56374, anticorps DDBDRAFT_0190542, anticorps DDBDRAFT_0232932, anticorps DDB_0190542, anticorps DDB_0232932, anticorps proteasome subunit beta 3, anticorps proteasome (prosome, macropain) subunit, beta type 3, anticorps proteasome subunit C10-11, anticorps proteasome subunit beta type-3, anticorps proteasome subunit beta 3 S homeolog, anticorps 20S proteasome subunit beta-3, anticorps PSMB3, anticorps Psmb3, anticorps LOC100135869, anticorps LOC399377, anticorps psmb3.S, anticorps psmb3, anticorps psmB3

Sujet: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.

Poids moléculaire: 23 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA, Cell RedoxHomeostasis, Lipid Metabolism