PDE12 anticorps (Middle Region)

N° du produit ABIN630935

Détail du produit anti-PDE12 anticorps

Antigène: PDE12 (Phosphodiesterase 12 (PDE12))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDE12 est non-conjugé

Application: Western Blotting (WB)

Specificité: 2'-PDE antibody was raised against the middle region of 2'-Pde

Purification: Affinity purified

Immunogène: 2'-PDE antibody was raised using the middle region of 2'-Pde corresponding to a region with amino acids CLDYIFIDLNALEVEQVIPLPSHEEVTTHQALPSVSHPSDHIALVCDLKW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

2'-PDE Blocking Peptide, catalog no. 33R-1734, is also available for use as a blocking control in assays to test for specificity of this 2'-PDE antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 2'-PDE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDE12

Antigène: PDE12 (Phosphodiesterase 12 (PDE12))

Autre désignation: 2'-PDE (PDE12 Produits)

Synonymes: anticorps 2'-PDE, anticorps E430028B21Rik, anticorps LRRGT00074, anticorps RGD1310975, anticorps phosphodiesterase 12 S homeolog, anticorps phosphodiesterase 12, anticorps pde12.S, anticorps PDE12, anticorps pde12, anticorps Pde12

Sujet: 2'-PDE is an enzyme that cleaves 2',5'-phosphodiester bond linking adenosines of the 5'-triphosphorylated oligoadenylates, triphosphorylated oligoadenylates referred as 2-5A modulates the 2-5A system. This enzyme degraded triphosphorylated 2-5A to produce AMP and ATP. 2'-PDE also cleaves 3',5'-phosphodiester bond of oligoadenylates. 2'-PDE play a role as a negative regulator of the 2-5A system that is one of the major pathways for antiviral and antitumor functions induced by interferons (IFNs). Suppression of this enzyme induces reduction of viral replication in Hela cells, thus counteracting the antiviral pathway probably by inhibiting the 2-5A system.

Poids moléculaire: 67 kDa (MW of target protein)