Band 3/AE1 anticorps
-
- Antigène Voir toutes Band 3/AE1 (SLC4A1) Anticorps
- Band 3/AE1 (SLC4A1) (Solute Carrier Family 4, Anion Exchanger, Member 1 (erythrocyte Membrane Protein Band 3, Diego Blood Group) (SLC4A1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Band 3/AE1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC4 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGR
- Top Product
- Discover our top product SLC4A1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC4A1 Blocking Peptide, catalog no. 33R-7368, is also available for use as a blocking control in assays to test for specificity of this SLC4A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Band 3/AE1 (SLC4A1) (Solute Carrier Family 4, Anion Exchanger, Member 1 (erythrocyte Membrane Protein Band 3, Diego Blood Group) (SLC4A1))
- Autre désignation
- SLC4A1 (SLC4A1 Produits)
- Synonymes
- anticorps AE1, anticorps BND3, anticorps CD233, anticorps DI, anticorps EMPB3, anticorps EPB3, anticorps FR, anticorps RTA1A, anticorps SW, anticorps WD, anticorps WD1, anticorps WR, anticorps Ae1, anticorps Empb3, anticorps l11Jus51, anticorps ae1, anticorps band3, anticorps MGC152771, anticorps zgc:111889, anticorps zgc:152771, anticorps si:dz180g5.1, anticorps LOC100136769, anticorps slc4a1, anticorps wd1, anticorps bnd3, anticorps epb3, anticorps cd233, anticorps empb3, anticorps rta1a, anticorps MGC80391, anticorps SLC4A1, anticorps BB3, anticorps EAT, anticorps solute carrier family 4 member 1 (Diego blood group), anticorps solute carrier family 4 (anion exchanger), member 1, anticorps solute carrier family 4 (anion exchanger), member 1a (Diego blood group), anticorps Band 3, anticorps erythrocyte membrane protein band 4.1 like 3, anticorps solute carrier family 4 member 1 (Diego blood group) L homeolog, anticorps solute carrier family 4 member 1, anticorps SLC4A1, anticorps Slc4a1, anticorps slc4a1a, anticorps LOC100136769, anticorps EPB41L3, anticorps slc4a1.L, anticorps slc4a1
- Sujet
- The CD233 gene is located on chromosome 17q21-q22 and is part of the anion exchanger (AE) family. CD233 is expressed in the erythrocyte plasma membrane where it functions as a chloride/bicarbonate exchanger involved in carbon dioxide transport from tissues to lungs. The protein comprises two domains that are structurally and functionally distinct. The N-terminal 40 kDa domain is located in the cytoplasm and acts as an attachment site for the red cell skeleton by binding ankyrin. The glycosylated C-terminal membrane-associated domain contains 12-14 membrane spanning segments and carries out the stilbene disulphonate-sensitive exchange transport of anions. The cytoplasmic tail at the extreme C-terminus of the membrane domain binds carbonic anhydrase II. CD233 associates with the red cell membrane protein glycophorin A and this association promotes the correct folding and translocation of CD233.
- Poids moléculaire
- 102 kDa (MW of target protein)
-