NDUFV3 anticorps
-
- Antigène Voir toutes NDUFV3 Anticorps
- NDUFV3 (NADH Dehydrogenase (Ubiquinone) Flavoprotein 3, 10kDa (NDUFV3))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NDUFV3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- NDUFV3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPR
- Top Product
- Discover our top product NDUFV3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NDUFV3 Blocking Peptide, catalog no. 33R-6975, is also available for use as a blocking control in assays to test for specificity of this NDUFV3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFV3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NDUFV3 (NADH Dehydrogenase (Ubiquinone) Flavoprotein 3, 10kDa (NDUFV3))
- Autre désignation
- NDUFV3 (NDUFV3 Produits)
- Synonymes
- anticorps CI-10k, anticorps CI-9KD, anticorps Mipp65, anticorps Ndufv3l, anticorps 1500032D16Rik, anticorps wu:fl83h06, anticorps NADH:ubiquinone oxidoreductase subunit V3, anticorps NADH dehydrogenase (ubiquinone) flavoprotein 3, anticorps NDUFV3, anticorps Ndufv3, anticorps ndufv3
- Sujet
- The protein encoded by this gene is one of at least forty-one subunits that make up the NADH-ubiquinone oxidoreductase complex. This complex is part of the mitochondrial respiratory chain and serves to catalyze the rotenone-sensitive oxidation of NADH and
- Poids moléculaire
- 47 kDa (MW of target protein)
-