MRPL28 anticorps (Middle Region)
-
- Antigène Voir toutes MRPL28 Anticorps
- MRPL28 (Mitochondrial Ribosomal Protein L28 (MRPL28))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MRPL28 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MRPL28 antibody was raised against the middle region of MRPL28
- Purification
- Affinity purified
- Immunogène
- MRPL28 antibody was raised using the middle region of MRPL28 corresponding to a region with amino acids EDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFK
- Top Product
- Discover our top product MRPL28 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MRPL28 Blocking Peptide, catalog no. 33R-2324, is also available for use as a blocking control in assays to test for specificity of this MRPL28 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL28 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MRPL28 (Mitochondrial Ribosomal Protein L28 (MRPL28))
- Autre désignation
- MRPL28 (MRPL28 Produits)
- Synonymes
- anticorps MAAT1, anticorps p15, anticorps CG3782, anticorps Dmel\\CG3782, anticorps MRP-L28, anticorps 1110015G04Rik, anticorps L28mt, anticorps GB14554, anticorps MRPL28, anticorps maat1, anticorps wu:fa96b11, anticorps zgc:110013, anticorps mitochondrial ribosomal protein L28, anticorps 39S ribosomal protein L28, mitochondrial, anticorps mitochondrial ribosomal protein L28 L homeolog, anticorps mitochondrial 54S ribosomal protein YmL28, anticorps mitochondrial ribosomal protein subunit L28 (predicted), anticorps Putative mitochondrial ribosomal protein L28, anticorps MRPL28, anticorps mRpL28, anticorps Mrpl28, anticorps LOC412473, anticorps mrpl28.L, anticorps mrpl28, anticorps CAALFM_C108520CA
- Sujet
- Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit.
- Poids moléculaire
- 30 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases
-