SDHB anticorps

N° du produit ABIN631009

Détail du produit anti-SDHB anticorps

Antigène: SDHB (Succinate Dehydrogenase Complex, Subunit B, Iron Sulfur (Ip) (SDHB))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SDHB est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SDHB antibody was raised using a synthetic peptide corresponding to a region with amino acids YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SDHB Blocking Peptide, catalog no. 33R-10234, is also available for use as a blocking control in assays to test for specificity of this SDHB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDHB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SDHB

Antigène: SDHB (Succinate Dehydrogenase Complex, Subunit B, Iron Sulfur (Ip) (SDHB))

Autre désignation: SDHB (SDHB Produits)

Synonymes: anticorps succinate dehydrogenase 2-3, anticorps CG3283, anticorps Dmel\\CG3283, anticorps Ip, anticorps SDH, anticorps SDH-IP, anticorps SDH-Ip, anticorps SDHb, anticorps sdhB, anticorps CWS2, anticorps IP, anticorps PGL4, anticorps SDH1, anticorps SDH2, anticorps SDHIP, anticorps 0710008N11Rik, anticorps fj46d06, anticorps wu:fj46d06, anticorps succinate dehydrogenase complex iron sulfur subunit B, anticorps succinate dehydrogenase [ubiquinone] iron-sulfur subunit 3, anticorps Succinate dehydrogenase, subunit B (iron-sulfur), anticorps succinate dehydrogenase complex subunit B, iron sulfur (Ip), anticorps succinate dehydrogenase complex, subunit B, iron sulfur (Ip), anticorps succinate dehydrogenase complex subunit B, iron sulfur (Ip) S homeolog, anticorps SDHB, anticorps SDH2-3, anticorps SdhB, anticorps sdhb, anticorps Sdhb, anticorps sdhb.S

Sujet: Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis.

Poids moléculaire: 31 kDa (MW of target protein)