PDK2 anticorps (Middle Region)

N° du produit ABIN631027

Cet anticorps Lapin Polyclonal détecte spécifiquement PDK2 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour PDK2 anticorps (Middle Region) (ABIN631027)

Antigène: PDK2 (Pyruvate Dehydrogenase Kinase, Isozyme 2 (PDK2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDK2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PDK2 anticorps

Épitope: Middle Region

Specificité: PDK2 antibody was raised against the middle region of PDK2

Purification: Affinity purified

Immunogène: PDK2 antibody was raised using the middle region of PDK2 corresponding to a region with amino acids ELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDK2 Blocking Peptide, (ABIN937927), is also available for use as a blocking control in assays to test for specificity of this PDK2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDK2

Antigène: PDK2 (Pyruvate Dehydrogenase Kinase, Isozyme 2 (PDK2))

Autre désignation: PDK2

Sujet: PDK2 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.

Poids moléculaire: 44 kDa (MW of target protein)

Pathways: Signalisation PI3K-Akt, Signalisation RTK, Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, L'effet Warburg