Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

PCK1 anticorps (Soluble)

PCK1 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN631057
  • Antigène Voir toutes PCK1 Anticorps
    PCK1 (phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1))
    Épitope
    • 15
    • 9
    • 8
    • 4
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Soluble
    Reactivité
    • 73
    • 54
    • 29
    • 8
    • 6
    • 5
    • 5
    • 4
    • 4
    • 3
    • 3
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Humain
    Hôte
    • 87
    • 9
    • 2
    • 2
    Lapin
    Clonalité
    • 84
    • 16
    Polyclonal
    Conjugué
    • 47
    • 9
    • 6
    • 6
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp PCK1 est non-conjugé
    Application
    • 84
    • 38
    • 27
    • 14
    • 14
    • 13
    • 10
    • 9
    • 4
    • 3
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Purification
    Affinity purified
    Immunogène
    PCK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEE
    Top Product
    Discover our top product PCK1 Anticorps primaire
  • Indications d'application
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Commentaires

    PCK1 Blocking Peptide, catalog no. 33R-7272, is also available for use as a blocking control in assays to test for specificity of this PCK1 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCK1 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Conseil sur la manipulation
    Avoid repeated freeze/thaw cycles.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Antigène
    PCK1 (phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1))
    Autre désignation
    PCK1 (PCK1 Produits)
    Synonymes
    anticorps PEPCK-C, anticorps PEPCK1, anticorps PEPCKC, anticorps PEPCK, anticorps PEPCK-M, anticorps PEPCK2, anticorps 1810010O14Rik, anticorps 9130022B02Rik, anticorps cb856, anticorps cb924, anticorps fj93h11, anticorps zgc:63869, anticorps wu:fc51c05, anticorps wu:fj93h11, anticorps pepck-c, anticorps pepck1, anticorps pepckc, anticorps PCK1, anticorps PPCK1, anticorps AI265463, anticorps Pck-1, anticorps GTP, anticorps PCK, anticorps Pepck, anticorps RATPEPCK, anticorps Ppc1C, anticorps PHOSPHOENOLPYRUVATE CARBOXYKINASE, anticorps T28I19.150, anticorps T28I19_150, anticorps phosphoenolpyruvate carboxykinase 1, anticorps 143299_at, anticorps CG10924, anticorps CG17725, anticorps Dmel\\CG17725, anticorps Dromel_CG17725_FBtr0086701_pepck_mORF, anticorps dPEPCK, anticorps pepck, anticorps PEPC, anticorps PEPCase, anticorps ppc, anticorps phosphoenolpyruvate carboxykinase 1, anticorps phosphoenolpyruvate carboxykinase 2, mitochondrial, anticorps phosphoenolpyruvate carboxykinase 2 (mitochondrial), anticorps phosphoenolpyruvate carboxykinase 1 (soluble), anticorps phosphoenolpyruvate carboxykinase 1 S homeolog, anticorps phosphoenolpyruvate carboxykinase, cytosolic [GTP], anticorps phosphoenolpyruvate carboxykinase 1, cytosolic, anticorps phosphoenolpyruvate carboxylase 7, anticorps Phosphoenolpyruvate carboxykinase, anticorps phosphoenolpyruvate carboxylase, anticorps PCK1, anticorps PCK2, anticorps Pck2, anticorps pck1, anticorps pck1.S, anticorps LOC100634531, anticorps Pck1, anticorps pep7, anticorps Pepck, anticorps LOC107777405
    Sujet
    PCK1 is a main control point for the regulation of gluconeogenesis. PCK1, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of PCK1 can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet. Defects in this gene are a cause of cytosolic phosphoenolpyruvate carboxykinase deficiency. This gene is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of this gene can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet. Defects in this gene are a cause of cytosolic phosphoenolpyruvate carboxykinase deficiency. A mitochondrial isozyme of the encoded protein also has been characterized.
    Poids moléculaire
    69 kDa (MW of target protein)
    Pathways
    Positive Regulation of Peptide Hormone Secretion, Carbohydrate Homeostasis
Vous êtes ici:
Support technique