ETFA anticorps
-
- Antigène Voir toutes ETFA Anticorps
- ETFA (Electron-Transfer-Flavoprotein, alpha Polypeptide (ETFA))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ETFA est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ETFA antibody was raised using a synthetic peptide corresponding to a region with amino acids VVSGGRGLKSGENFKLLYDLADQLHAAVGASRAAVDAGFVPNDMQVGQTG
- Top Product
- Discover our top product ETFA Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ETFA Blocking Peptide, catalog no. 33R-9895, is also available for use as a blocking control in assays to test for specificity of this ETFA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ETFA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ETFA (Electron-Transfer-Flavoprotein, alpha Polypeptide (ETFA))
- Autre désignation
- ETFA (ETFA Produits)
- Synonymes
- anticorps 2010200I21Rik, anticorps D9Ertd394e, anticorps ETF, anticorps EMA, anticorps GA2, anticorps MADD, anticorps cb1020, anticorps fd06h11, anticorps wu:fd06h11, anticorps ema, anticorps ga2, anticorps madd, anticorps electron transfer flavoprotein alpha subunit, anticorps electron-transfer-flavoprotein, alpha polypeptide, anticorps putative electron-transfer-flavoprotein,alpha polypeptide, anticorps electron transfer flavoprotein subunit alpha, mitochondrial, anticorps electron transferring flavoprotein, alpha polypeptide, anticorps electron transfer flavoprotein alpha subunit L homeolog, anticorps ETFA, anticorps Tc00.1047053503559.109, anticorps Tc00.1047053511693.90, anticorps LMJF_28_1140, anticorps LOC100194695, anticorps etfa, anticorps Etfa, anticorps etfa.L
- Sujet
- ETFA participates in catalyzing the initial step of the mitochondrial fatty acid beta-oxidation. It shuttles electrons between primary flavoprotein dehydrogenases and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. Defects in electron-transfer-flavoprotein have been implicated in type II glutaricaciduria in which multiple acyl-CoA dehydrogenase deficiencies result in large excretion of glutaric, lactic, ethylmalonic, butyric, isobutyric, 2-methyl-butyric, and isovaleric acids.
- Poids moléculaire
- 35 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-