ATP6V1B2 anticorps (N-Term)

N° du produit ABIN631079

Détail du produit anti-ATP6V1B2 anticorps

Antigène: ATP6V1B2 (ATPase, H+ Transporting, Lysosomal 56/58kDa, V1 Subunit B2 (ATP6V1B2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATP6V1B2 est non-conjugé

Application: Western Blotting (WB)

Specificité: ATP6 V6 2 antibody was raised against the N terminal of ATP6 6 2

Purification: Affinity purified

Immunogène: ATP6 V6 2 antibody was raised using the N terminal of ATP6 6 2 corresponding to a region with amino acids VSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATP6V1B2 Blocking Peptide, catalog no. 33R-9821, is also available for use as a blocking control in assays to test for specificity of this ATP6V1B2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATP6V1B2

Antigène: ATP6V1B2 (ATPase, H+ Transporting, Lysosomal 56/58kDa, V1 Subunit B2 (ATP6V1B2))

Autre désignation: ATP6V1B2 (ATP6V1B2 Produits)

Synonymes: anticorps Atp6b1b2, anticorps Atp6b2, anticorps Vatb, anticorps vha55, anticorps VATB, anticorps ATP6B1B2, anticorps ATP6B2, anticorps HO57, anticorps VPP3, anticorps Vma2, anticorps atp6v1bb, anticorps fj51e01, anticorps vatB2, anticorps wu:fj51e01, anticorps zgc:109771, anticorps AI194269, anticorps AI790362, anticorps R74844, anticorps ATPase H+ transporting V1 subunit B2, anticorps ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2 S homeolog, anticorps ATPase, H+ transporting, lysosomal, V1 subunit B2, anticorps ATPase, H+ transporting, lysosomal V1 subunit B2, anticorps Atp6v1b2, anticorps atp6v1b2.S, anticorps ATP6V1B2, anticorps atp6v1b2

Sujet: ATP6V1B2 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. ATP6V1B2 is one of two V1 domain B subunit isoforms and is the only B isoform highly expressed in osteoclasts.

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Proton Transport