NDUFA9 anticorps

N° du produit ABIN631081

Détail du produit anti-NDUFA9 anticorps

Antigène: NDUFA9 (NADH Dehydrogenase (Ubiquinone) 1 alpha Subcomplex, 9, 39kDa (NDUFA9))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NDUFA9 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: NDUFA9 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NDUFA9 Blocking Peptide, catalog no. 33R-7627, is also available for use as a blocking control in assays to test for specificity of this NDUFA9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFA9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NDUFA9

Antigène: NDUFA9 (NADH Dehydrogenase (Ubiquinone) 1 alpha Subcomplex, 9, 39kDa (NDUFA9))

Autre désignation: NDUFA9 (NDUFA9 Produits)

Synonymes: anticorps ndufs2l, anticorps wu:fc41f12, anticorps zgc:112513, anticorps GB10406, anticorps NDUFA9, anticorps DDBDRAFT_0203708, anticorps DDBDRAFT_0302549, anticorps DDB_0203708, anticorps DDB_0302549, anticorps 1010001N11Rik, anticorps CC6, anticorps CI-39k, anticorps CI39k, anticorps NDUFS2L, anticorps SDR22E1, anticorps NADH:ubiquinone oxidoreductase subunit A9, anticorps NADH:ubiquinone oxidoreductase subunit A9 L homeolog, anticorps NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9a, anticorps NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial, anticorps NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9, anticorps NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa, anticorps NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, anticorps NDUFA9, anticorps ndufa9.L, anticorps ndufa9, anticorps ndufa9a, anticorps LOC551866, anticorps Ndufa9

Sujet: The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane.

Poids moléculaire: 42 kDa (MW of target protein)