IDH2 anticorps

N° du produit ABIN631096

Détail du produit anti-IDH2 anticorps

Antigène: IDH2 (Isocitrate Dehydrogenase 2 (NADP+), Mitochondrial (IDH2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IDH2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: IDH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IDH2 Blocking Peptide, catalog no. 33R-3304, is also available for use as a blocking control in assays to test for specificity of this IDH2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IDH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IDH2

Antigène: IDH2 (Isocitrate Dehydrogenase 2 (NADP+), Mitochondrial (IDH2))

Autre désignation: IDH2 (IDH2 Produits)

Synonymes: anticorps F6P23.14, anticorps F6P23_14, anticorps IDH-II, anticorps NAD+ DEPENDENT ISOCITRATE DEHYDROGENASE SUBUNIT 2, anticorps isocitrate dehydrogenase II, anticorps isocitrate dehydrogenase subunit 2, anticorps D2HGA2, anticorps ICD-M, anticorps IDH, anticorps IDHM, anticorps IDP, anticorps IDPM, anticorps mNADP-IDH, anticorps E430004F23, anticorps IDPm, anticorps Idh-2, anticorps wu:fb33c06, anticorps wu:fk31e05, anticorps wu:fq43b01, anticorps zgc:55485, anticorps idh2, anticorps IDH2, anticorps isocitrate dehydrogenase subunit 2, anticorps isocitrate dehydrogenase (NADP(+)) 2, mitochondrial, anticorps isocitrate dehydrogenase 2 (NADP+), mitochondrial, anticorps isocitrate dehydrogenase 2 (NADP+), mitochondrial S homeolog, anticorps isocitrate dehydrogenase [NADP], mitochondrial, anticorps IDH2, anticorps Idh2, anticorps idh2.S, anticorps idh2, anticorps LOC100441867

Sujet: Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: L'effet Warburg