Ferredoxin Reductase anticorps (Middle Region)

N° du produit ABIN631105

Détail du produit anti-Ferredoxin Reductase anticorps

Antigène: Ferredoxin Reductase (FDXR)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Ferredoxin Reductase est non-conjugé

Application: Western Blotting (WB)

Specificité: FDXR antibody was raised against the middle region of FDXR

Purification: Affinity purified

Immunogène: FDXR antibody was raised using the middle region of FDXR corresponding to a region with amino acids LDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FDXR Blocking Peptide, catalog no. 33R-4855, is also available for use as a blocking control in assays to test for specificity of this FDXR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FDXR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Ferredoxin Reductase

Antigène: Ferredoxin Reductase (FDXR)

Autre désignation: FDXR (FDXR Produits)

Synonymes: anticorps AR, anticorps AdR, anticorps FDXR, anticorps PSPTO4024, anticorps ADXR, anticorps fdxr, anticorps ferredoxin reductase, anticorps ferredoxin--NADP reductase, anticorps ferredoxin--NADP reductase Fpr, anticorps ferredoxin reductase L homeolog, anticorps FDXR, anticorps Fdxr, anticorps fnr-1, anticorps fpr, anticorps SPO2637, anticorps fdxr.L

Sujet: FDXR is a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from NADPH.

Poids moléculaire: 54 kDa (MW of target protein)