TRIM63 anticorps (Middle Region)

N° du produit ABIN631125

Détail du produit anti-TRIM63 anticorps

Antigène: TRIM63 (Tripartite Motif Containing 63 (TRIM63))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRIM63 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRIM63 antibody was raised against the middle region of TRIM63

Purification: Affinity purified

Immunogène: TRIM63 antibody was raised using the middle region of TRIM63 corresponding to a region with amino acids EQLDKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRIM63 Blocking Peptide, catalog no. 33R-2669, is also available for use as a blocking control in assays to test for specificity of this TRIM63 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM63 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRIM63

Antigène: TRIM63 (Tripartite Motif Containing 63 (TRIM63))

Autre désignation: TRIM63 (TRIM63 Produits)

Synonymes: anticorps IRF, anticorps MURF1, anticorps MURF2, anticorps RNF28, anticorps SMRZ, anticorps Murf, anticorps Murf1, anticorps Rnf28, anticorps MuRF1, anticorps RF1, anticorps rnf30, anticorps MGC80210, anticorps TRIM63, anticorps MuRF, anticorps fc50c07, anticorps trim63, anticorps wu:fc50c07, anticorps zgc:86757, anticorps tripartite motif containing 63, anticorps tripartite motif-containing 63, anticorps tripartite motif containing 63 S homeolog, anticorps tripartite motif containing 63a, anticorps TRIM63, anticorps Trim63, anticorps trim63.S, anticorps trim63a

Sujet: This gene encodes a member of the RING zinc finger protein family found in striated muscle and iris. The product of this gene is localized to the Z-line and M-line lattices of myofibrils, where titin's N-terminal and C-terminal regions respectively bind to the sarcomere. In vitro binding studies have shown that this protein also binds directly to titin near the region of titin containing kinase activity. Another member of this protein family binds to microtubules. Since these family members can form heterodimers, this suggests that these proteins may serve as a link between titin kinase and microtubule-dependent signal pathways in muscle.

Poids moléculaire: 40 kDa (MW of target protein)