SHC3 anticorps

N° du produit ABIN631135

Cet anticorps Lapin Polyclonal détecte spécifiquement SHC3 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour SHC3 anticorps (ABIN631135)

Antigène: SHC3 (SHC (Src Homology 2 Domain Containing) Transforming Protein 3 (SHC3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SHC3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SHC3 anticorps

Purification: Affinity purified

Immunogène: SHC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLKPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYST

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SHC3 Blocking Peptide, (ABIN5616130), is also available for use as a blocking control in assays to test for specificity of this SHC3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SHC3

Antigène: SHC3 (SHC (Src Homology 2 Domain Containing) Transforming Protein 3 (SHC3))

Autre désignation: SHC3

Sujet: SHC3 is a signaling adapter that couples activated growth factor receptors to signaling pathway in neurons. SHC3 is involved in the signal transduction pathways of neurotrophin-activated Trk receptors in cortical neurons.

Poids moléculaire: 64 kDa (MW of target protein)

Pathways: Signalisation RTK, EGFR Signaling Pathway, Neurotrophin Signaling Pathway