SHC3 anticorps
-
- Antigène Voir toutes SHC3 Anticorps
- SHC3 (SHC (Src Homology 2 Domain Containing) Transforming Protein 3 (SHC3))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SHC3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SHC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLKPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYST
- Top Product
- Discover our top product SHC3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SHC3 Blocking Peptide, catalog no. 33R-8036, is also available for use as a blocking control in assays to test for specificity of this SHC3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHC3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SHC3 (SHC (Src Homology 2 Domain Containing) Transforming Protein 3 (SHC3))
- Autre désignation
- SHC3 (SHC3 Produits)
- Synonymes
- anticorps N-Shc, anticorps NSHC, anticorps RAI, anticorps SHCC, anticorps ShcC, anticorps Rai, anticorps SHC adaptor protein 3, anticorps src homology 2 domain-containing transforming protein C3, anticorps SHC3, anticorps Shc3
- Sujet
- SHC3 is a signaling adapter that couples activated growth factor receptors to signaling pathway in neurons. SHC3 is involved in the signal transduction pathways of neurotrophin-activated Trk receptors in cortical neurons.
- Poids moléculaire
- 64 kDa (MW of target protein)
- Pathways
- Signalisation RTK, EGFR Signaling Pathway, Neurotrophin Signaling Pathway
-