TGS1 anticorps
-
- Antigène Voir toutes TGS1 Anticorps
- TGS1 (Trimethylguanosine Synthase 1 (TGS1))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TGS1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- TGS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDENPASDFDDSGSLLGFKYGSGQKYGGIPNFSHRQVRYLEKNVKLKSKY
- Top Product
- Discover our top product TGS1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TGS1 Blocking Peptide, catalog no. 33R-3910, is also available for use as a blocking control in assays to test for specificity of this TGS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TGS1 (Trimethylguanosine Synthase 1 (TGS1))
- Autre désignation
- TGS1 (TGS1 Produits)
- Synonymes
- anticorps NCOA6IP, anticorps PIMT, anticorps PIPMT, anticorps D4Ertd800e, anticorps Ncoa6ip, anticorps Pimt, anticorps trimethylguanosine synthase 1, anticorps trimethylguanosine synthase 1 L homeolog, anticorps TGS1, anticorps Tgs1, anticorps tgs1.L
- Sujet
- TGS1 catalyzes the methylation step(s) for the conversion of the 7-monomethylguanosine (m7G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure. TGS1 plays a role in transcriptional regulation.
- Poids moléculaire
- 96 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, Regulation of Lipid Metabolism by PPARalpha, Ribonucleoprotein Complex Subunit Organization
-