TGS1 anticorps

N° du produit ABIN631136

Détail du produit anti-TGS1 anticorps

Antigène: TGS1 (Trimethylguanosine Synthase 1 (TGS1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TGS1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: TGS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDENPASDFDDSGSLLGFKYGSGQKYGGIPNFSHRQVRYLEKNVKLKSKY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TGS1 Blocking Peptide, catalog no. 33R-3910, is also available for use as a blocking control in assays to test for specificity of this TGS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TGS1

Antigène: TGS1 (Trimethylguanosine Synthase 1 (TGS1))

Autre désignation: TGS1 (TGS1 Produits)

Synonymes: anticorps NCOA6IP, anticorps PIMT, anticorps PIPMT, anticorps D4Ertd800e, anticorps Ncoa6ip, anticorps Pimt, anticorps trimethylguanosine synthase 1, anticorps trimethylguanosine synthase 1 L homeolog, anticorps TGS1, anticorps Tgs1, anticorps tgs1.L

Sujet: TGS1 catalyzes the methylation step(s) for the conversion of the 7-monomethylguanosine (m7G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure. TGS1 plays a role in transcriptional regulation.

Poids moléculaire: 96 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, Regulation of Lipid Metabolism by PPARalpha, Ribonucleoprotein Complex Subunit Organization