TNNT1 anticorps

N° du produit ABIN631158

Détail du produit anti-TNNT1 anticorps

Antigène: TNNT1 (Slow Skeletal Troponin T (TNNT1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TNNT1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Troponin T Type 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Troponin T Type 1 Blocking Peptide, catalog no. 33R-9957, is also available for use as a blocking control in assays to test for specificity of this Troponin T Type 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNNT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TNNT1

Antigène: TNNT1 (Slow Skeletal Troponin T (TNNT1))

Abstract: TNNT1 Produits

Synonymes: anticorps ANM, anticorps NEM5, anticorps STNT, anticorps TNT, anticorps TNTS, anticorps TNNI1, anticorps AW146156, anticorps Tnt, anticorps sTnT, anticorps ssTnT, anticorps Fang2, anticorps tnTs, anticorps Tnnt, anticorps zgc:193831, anticorps zgc:193865, anticorps troponin T1, slow skeletal type, anticorps troponin I1, slow skeletal type, anticorps troponin T1, skeletal, slow, anticorps troponin T1, slow skeletal type S homeolog, anticorps troponin T type 1 (skeletal, slow), anticorps TNNT1, anticorps TNNI1, anticorps Tnnt1, anticorps tnnt1.S, anticorps tnnt1

Sujet: TNNT1 is a protein that is a subunit of troponin, which is a regulatory complex located on the thin filament of the sarcomere. This complex regulates striated muscle contraction in response to fluctuations in intracellular calcium concentration. This complex is composed of three subunits: troponin C, which binds calcium, troponin T, which binds tropomyosin, and troponin I, which is an inhibitory subunit. This protein is the slow skeletal troponin T subunit. Mutations in this gene cause nemaline myopathy type 5, also known as Amish nemaline myopathy, a neuromuscular disorder characterized by muscle weakness and rod-shaped, or nemaline, inclusions in skeletal muscle fibers which affects infants, resulting in death due to respiratory insufficiency, usually in the second year.

Poids moléculaire: 33 kDa (MW of target protein)