PYGB anticorps (N-Term)
-
- Antigène Voir toutes PYGB (GPBB) Anticorps
- PYGB (GPBB) (phosphorylase, Glycogen, Brain (GPBB))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PYGB est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PYGB antibody was raised against the N terminal of PYGB
- Purification
- Affinity purified
- Immunogène
- PYGB antibody was raised using the N terminal of PYGB corresponding to a region with amino acids ADDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDGVKWLDTQVVLAMPYDT
- Top Product
- Discover our top product GPBB Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PYGB Blocking Peptide, catalog no. 33R-1085, is also available for use as a blocking control in assays to test for specificity of this PYGB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PYGB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PYGB (GPBB) (phosphorylase, Glycogen, Brain (GPBB))
- Autre désignation
- PYGB (GPBB Produits)
- Synonymes
- anticorps GPBB, anticorps GLYPHOA, anticorps glycogen phosphorylase B, anticorps phosphorylase, glycogen; brain, anticorps brain glycogen phosphorylase, anticorps phosphorylase, glycogen; brain S homeolog, anticorps PYGB, anticorps pygb, anticorps Pygb, anticorps pygb.S
- Sujet
- PYGB is a glycogen phosphorylase found predominantly in the brain. It forms homodimers which can associate into homotetramers, the enzymatically active form of glycogen phosphorylase. The activity of this enzyme is positively regulated by AMP and negatively regulated by ATP, ADP, and glucose-6-phosphate. This enzyme catalyzes the rate-determining step in glycogen degradation.
- Poids moléculaire
- 97 kDa (MW of target protein)
- Pathways
- Cellular Glucan Metabolic Process
-