PIAS2 anticorps (N-Term)

N° du produit ABIN631219

Détail du produit anti-PIAS2 anticorps

Antigène: PIAS2 (Protein Inhibitor of Activated STAT, 2 (PIAS2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PIAS2 est non-conjugé

Application: Western Blotting (WB)

Specificité: PIAS2 antibody was raised against the N terminal of PIAS2

Purification: Affinity purified

Immunogène: PIAS2 antibody was raised using the N terminal of PIAS2 corresponding to a region with amino acids RELYRRRYPRTLEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPST

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PIAS2 Blocking Peptide, catalog no. 33R-7881, is also available for use as a blocking control in assays to test for specificity of this PIAS2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIAS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PIAS2

Antigène: PIAS2 (Protein Inhibitor of Activated STAT, 2 (PIAS2))

Autre désignation: PIAS2 (PIAS2 Produits)

Synonymes: anticorps MGC83751, anticorps piasx, anticorps wu:fi05f09, anticorps PIAS2, anticorps 6330408K17Rik, anticorps AI462206, anticorps ARIP3, anticorps AU018068, anticorps Dib, anticorps Miz1, anticorps PIASxalpha, anticorps PIASxb, anticorps PIASxbeta, anticorps SIZ2, anticorps DIP, anticorps MIZ, anticorps MIZ1, anticorps PIASX, anticorps PIASX-ALPHA, anticorps PIASX-BETA, anticorps ZMIZ4, anticorps protein inhibitor of activated STAT 2 L homeolog, anticorps protein inhibitor of activated STAT 2, anticorps protein inhibitor of activated STAT, 2, anticorps pias2.L, anticorps PIAS2, anticorps pias2, anticorps Pias2

Sujet: Pias2 functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. It plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53 pathway and the steroid hormone signaling pathway.

Poids moléculaire: 63 kDa (MW of target protein)

Pathways: Signalistation JAK/STAT, Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling