PPL anticorps (Middle Region)

N° du produit ABIN631225

Détail du produit anti-PPL anticorps

Antigène: PPL (Periplakin (PPL))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPL est non-conjugé

Application: Western Blotting (WB)

Specificité: Periplakin antibody was raised against the middle region of PPL

Purification: Affinity purified

Immunogène: Periplakin antibody was raised using the middle region of PPL corresponding to a region with amino acids EKSRAQEKVTEKEVVKLQNDPQLEAEYQQLQEDHQRQDQLREKQEEELSF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Periplakin Blocking Peptide, catalog no. 33R-2523, is also available for use as a blocking control in assays to test for specificity of this Periplakin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPL

Antigène: PPL (Periplakin (PPL))

Autre désignation: Periplakin (PPL Produits)

Synonymes: anticorps cb180, anticorps sb:cb180, anticorps im:7140067, anticorps im:7149519, anticorps AW553870, anticorps periplakin, anticorps periplakin L homeolog, anticorps PPL, anticorps ppl, anticorps ppl.L, anticorps Ppl

Sujet: PPL is a component of desmosomes and of the epidermal cornified envelope in keratinocytes. The N-terminal domain of this protein interacts with the plasma membrane and its C-terminus interacts with intermediate filaments. Through its rod domain, this protein forms complexes with envoplakin. This protein may serve as a link between the cornified envelope and desmosomes as well as intermediate filaments. AKT1/PKB, a protein kinase mediating a variety of cell growth and survival signaling processes, is reported to interact with this protein, suggesting a possible role for this protein as a localization signal in AKT1-mediated signaling.

Poids moléculaire: 205 kDa (MW of target protein)